(Pro3) GIP, human  (Synonyms: (Pro3) Gastric Inhibitory Peptide, human)

(Pro3) GIP, human ((Pro3) Gastric Inhibitory Peptide, human) is an efficacious, stable and specific human GIP receptor (hGIPR) full agonist. (Pro3) GIP, human has high binding affinity for human GIPR with K_i/ K_d values of 0.90 nM. (Pro3) GIP, human can be used for the research of obesity-related diabetes^[1][2].

EC50: 0.026 nM (hGIPR)^[2]
Ki/Kd: 0.90 nM (hGIPR); 1.1 nM (Rat GIPR); 0.72 nM (Mouse GIPR)^[2]

(Pro3) GIP, human induces cAMP accumulation with an EC₅₀ value of 0.026 nM^[2].
(Pro3) GIP, human has high binding affinity for human GIPR, Rat GIPR and Mouse GIPR with K_i/ K_d values of 0.90 nM, 1.1 nM and 0.72 nM, respectively^[2].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

(Pro3) GIP, human has comparatively weak partial agonist effect in rodent models^[2].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

4951.53

C₂₂₆H₃₃₈N₆₀O₆₄S

299898-52-5

固体

White to off-white

Tyr-Ala-Pro-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln

YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

Room temperature in continental US; may vary elsewhere.

Sealed storage, away from moisture and light

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

• [1]. Victor A Gault, et al. Chemical ablation of gastric inhibitory polypeptide receptor action by daily (Pro3)GIP administration improves glucose tolerance and ameliorates insulin resistance and abnormalities of islet structure in obesity-related diabetes. Diabetes. 2005 Aug;54(8):2436-46.  [Content Brief]

  [2]. A H Sparre-Ulrich, et al. Species-specific action of (Pro3)GIP - a full agonist at human GIP receptors, but a partial agonist and competitive antagonist at rat and mouse GIP receptors. Br J Pharmacol. 2016 Jan;173(1):27-38.  [Content Brief]