Parathyroid Hormone (1-34), bovine TFA 

Parathyroid Hormone (1-34), bovine TFA is a potent parathyroid hormone (PTH) receptor agonist. Parathyroid Hormone (1-34), bovine increases calcium and inorganic phosphate levels in vivo. Parathyroid Hormone (1-34), bovine can be used for th reseach of osteoporosis^[1].

Parathyroid Hormone (1-34), bovine (0.1-100 ng/mL; 2-20 days) are added to the medium, it inhibits osteoblast proliferation in a dose-dependent manner. In another group, bPTH are added to the culture medium from day 1 to day 10, but not from days 11 to 20, a rebound of proliferation is observed in the PTH Day 1–10 group after bPTH withdrawal^[1].
Parathyroid Hormone (1-34), bovine (0.1-100 ng/mL; 2-20 days) induces diverse effects on the calcium and phosphorus content of culture medium. The calcium and phosphorus content of culture medium in the PTH-C 100 ng/mL group are higher than in the control group^[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Parathyroid Hormone (1-34)(subcutaneous injection; 80 μg/kg; 5 days) increases serum osteocalcin concentrations without changing serum inorganic phosphate or calcium concentrations in either group of old animals. Serum 1,25-dihydroxyvitamin D concentrations are significantly higher in the PTH-treated senile female rats than the sex-matchedvehicle-treated controls^[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

4222.79

C₁₈₅H₂₈₉F₃N₅₄O₅₂S₂

AVSEIQFMHNGKHLSSMERVEWLRKKLQDVHNF

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. B H Mitlak, et al. Intermittent administration of bovine PTH-(1-34) increases serum 1,25-dihydroxyvitamin D concentrations and spinal bone density in senile (23 month) rats. J Bone Miner Res. 1992 May;7(5):479-84.  [Content Brief]

  [2]. M Takigawa, et al. Studies on chondrocytes from mandibular condylar cartilage, nasal septal cartilage, and spheno-occipital synchondrosis in culture. I. Morphology, growth, glycosaminoglycan synthesis, and responsiveness to bovine parathyroid hormone (1-34). J Dent Res. 1984 Jan;63(1):19-22.  [Content Brief]