Irisin 蛋白, Human/Mouse/Rat (HEK293, His)

Irisin Protein, Human/Mouse/Rat (HEK293, His) is a Irisin protein labeled with a His-flag. Irisin is a hormone derived from the fibronectin type III domain-containing (FNDC5) gene that can promote energy expenditure via thermogenesis^[1].

Irisin is a recently identified hormone derived from the fibronectin type III domain-containing (FNDC5) gene that is released mainly from skeletal muscle after exercise or exposure to cold. Irisin is mainly secreted by muscle and is increased with exercise. In particular, Irisin has been shown to have beneficial effects in adipose tissues, brain and bone^[2].
Recombinant Human/Mouse/Rat Irisin Protein (20-200 ng/ml; 24 hours) at low concentration has no effects on E-selectin expression. And when HUVECs are treated with high concentarion irisin (200 ng/ml), it results in soluble E-selectin concentrations similar to the levels detected in the control group treated with regular growth media^[1].

Human

HEK293

C-6*His

Q8NAU1 (D32-E143)

252995  [NCBI]

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

20-28 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.

• [1]. Karan S Rana, et al. Plasma irisin is elevated in type 2 diabetes and is associated with increased E-selectin levels. Cardiovasc Diabetol  [Content Brief]

  [2]. Hyeonwoo Kim, et al. Irisin Mediates Effects on Bone and Fat via αV Integrin Receptors. Cell  [Content Brief]