SHH 蛋白, Mouse (C25II)

SHH Protein, Mouse (C25II) is a recombinant mouse sonic hedgehog variant.

Sonic Hedgehog (SHH) is a secreted factor. The protein is heavily modified through cleavage and posttranslational modification and its release from producing cells can also be modulated by interactions with Dispatched, Scube2, and heparan sulfate proteoglycan. Sonic hedgehog (SHH) is the main ligand of hedgehog (Hh) pathway in mouse^[1][2].

The ED₅₀ is <2 μg/mL as measured by C3H/10T1/2 (CCL-226) cells, corresponding to a specific activity of >500 units/mg.

Mouse

E. coli

Tag Free

Q62226 (G26-G198)

20423  [NCBI]

IIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Approximately 19.7 kDa

Lyophilized powder.

Lyophilized after extensive dialysis against PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Garcia ADR, et al. The Elegance of Sonic Hedgehog: Emerging Novel Functions for a Classic Morphogen. J Neurosci. 2018 Oct 31;38(44):9338-9345.  [Content Brief]

  [2]. Gomes DC, et al. Sonic hedgehog signaling is active in human adrenal cortex development and deregulated in adrenocortical tumors. J Clin Endocrinol Metab. 2014 Jul;99(7):E1209-16.  [Content Brief]