pTH (1-37) (human) 

pTH (1-37) (human) is a fragment of parathyroid hormone (PTH). pTH (1-37) (human) induces the cAMP formation and increases alkaline phosphatase activity. pTH (1-37) (human) increases growth, bone calcium content, and bone mineral density (BMD) in uremic animals. pTH (1-37) (human) has the potential for the research of osteoporosis^[1][2][3].

4401.08

C₁₉₅H₃₁₆N₅₈O₅₄S₂

136799-54-7

Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-Val-Ala-Leu

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVAL

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. Tsai JA, et al. Parathyroid hormone-related protein (1-37) induces cAMP response in human osteoblast-like cells. Calcif Tissue Int. 1998 Mar;62(3):250-4.  [Content Brief]

  [2]. Schmitt CP, et al. Intermittent administration of parathyroid hormone (1-37) improves growth and bone mineral density in uremic rats. Kidney Int. 2000 Apr;57(4):1484-92.  [Content Brief]

  [3]. Stephan S, et al. Intermittent administration of the circulating form of human parathyroid hormone (hPTH-1-37) prevents bone loss in ovariectomized rats. Eur J Med Res. 2007 Jan 31;12(1):13-20.  [Content Brief]