GLP-1(7-36), amide  (Synonyms: Glucagon-like peptide-1 (GLP-1)(7-36), amide; Human GLP-1 (7-36), amide)

GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretion.

The sequence of Glucagon-Like Peptide after residue 7 shows similarities to glucagon and to other biologically active members of the secretin peptide family, particularly glucose-dependent insulinotropic peptide (GIP). This sequence has been especially well preserved, showing 66% nucleotide homology with GLP-1 in the proglucagon of the very primitive anglerfish. This 7-36 sequence of GLP-1 is a potent insulin-releasing peptide in vitro^[1]. Glucagon-Like Peptide (GLP) I (7-36), amide is a product of the tissue-specific post-translational processing of the glucagon precursor. It is released postprandially from intestinal endocrine L cells and stimulates insulin secretion. DPP IV is the main degradation enzyme for GLP-l(7 - 36)amide in human serum. Dipeptidyl-peptidase IV can initiate the metabolism of GIP and GLP-1(7-36)amide in human serum^[2].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Glucagon-Like Peptide (GLP) I (7-36), amide is a physiological incretin hormone that is released after nutrient intake from the lower gut and stimulates insulin secretion at elevated plasma glucose concentrations. Exogenous GLP-1 (7-36 amide) is an effective means of normalizing fasting plasma glucose concentrations in poorly-controlled Type 2 diabetic subjects^[3]. Exogenously administered GLP-1-(7–36)amide is extremely labile in vivo, with more than 80% being cleaved into GLP-1-(9–36)amide after sc or iv administration^[4].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

3297.68

C₁₄₉H₂₂₆N₄₀O₄₅

107444-51-9

His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. Kreymann B, et al. Glucagon-like peptide-1 7-36: a physiological incretin in man. Lancet. 1987 Dec 5;2(8571):1300-4.  [Content Brief]

  [2]. Mentlein R, et al. Dipeptidyl-peptidase IV hydrolyses gastric inhibitory polypeptide, glucagon-like peptide-1(7-36)amide, peptide histidine methionine and is responsible for their degradation in human serum. Eur J Biochem. 1993 Jun 15;214(3):829-35.  [Content Brief]

  [3]. Nauck MA, et al. Normalization of fasting hyperglycaemia by exogenous glucagon-like peptide 1 (7-36 amide) in type 2 (non-insulin-dependent) diabetic patients. Diabetologia. 1993 Aug;36(8):741-4.  [Content Brief]

  [4]. Hansen L, et al. Glucagon-like peptide-1-(7-36)amide is transformed to glucagon-like peptide-1-(9-36)amide by dipeptidyl peptidase IV in the capillaries supplying the L cells of the porcine intestine. Endocrinology. 1999 Nov;140(11):5356-63.  [Content Brief]