Tiprelestat 

Tiprelestat is a potent human neutrophil elastase inhibitor. Tiprelestat has antimicrobial and anti-inflammatory activities. Tiprelestat can be used in the research of inflammation/immune disease^[1].

Tiprelestat (4 and 8 μM) inhibits P. aeruginosa-secreted peptidase^[3].
Tiprelestat (10 μg/mL, 1 h) inhibits LPS-induced MCP-1 production in U937 cells^[4].
Tiprelestat (10 μg/mL, 1 h) down-regulates LPS-induced AP-1 and NF-κB activation in U937 cells^[4].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Tiprelestat (1 mg/kg, intranasal inhalation) suppresses lung elastase activity and apoptosis in MV-O₂ mice^[2].
Tiprelestat (0.2 mg/kg, s.c. for 2 weeks) attenuates hypoxic pulmonary hypertension in mice^[5].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

5999.09

C₂₅₄H₄₁₆N₇₂O₇₅S₁₀

820211-82-3

Ala-Gln-Glu-Pro-Val-Lys-Gly-Pro-Val-Ser-Thr-Lys-Pro-Gly-Ser-Cys-Pro-Ile-Ile-Leu-Ile-Arg-Cys-Ala-Met-Leu-Asn-Pro-Pro-Asn-Arg-Cys-Leu-Lys-Asp-Thr-Asp-Cys-Pro-Gly-Ile-Lys-Lys-Cys-Cys-Glu-Gly-Ser-Cys-Gly-Met-Ala-Cys-Phe-Val-Pro-Gln (Disulfide bridge: Cys16-Cys45, Cys23-Cys49, Cys32-Cys44, Cys38-Cys53)

AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disulfide bridge: Cys16-Cys45, Cys23-Cys49, Cys32-Cys44, Cys38-Cys53)

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. Wang J, et al. Elafin inhibits obesity, hyperglycemia, and liver steatosis in high-fat diet-treated male mice. Sci Rep. 2020 Jul 30;10(1):12785.  [Content Brief]

  [2]. Alejandre Alcazar MA, et al. Elafin Treatment Rescues EGFR-Klf4 Signaling and Lung Cell Survival in Ventilated Newborn Mice. Am J Respir Cell Mol Biol. 2018 Nov;59(5):623-634.

  [3]. Bellemare A, et al. Human pre-elafin inhibits a Pseudomonas aeruginosa-secreted peptidase and prevents its proliferation in complex media. Antimicrob Agents Chemother. 2008 Feb;52(2):483-90.  [Content Brief]

  [4]. Butler MW, et al. Elafin prevents lipopolysaccharide-induced AP-1 and NF-kappaB activation via an effect on the ubiquitin-proteasome pathway. J Biol Chem. 2006 Nov 17;281(46):34730-5.  [Content Brief]

  [5]. Nickel NP, et al. Elafin Reverses Pulmonary Hypertension via Caveolin-1-Dependent Bone Morphogenetic Protein Signaling. Am J Respir Crit Care Med. 2015 Jun 1;191(11):1273-86.  [Content Brief]