1. Academic Validation
  2. Structure and function of a potent lipopolysaccharide-binding antimicrobial and anti-inflammatory peptide

Structure and function of a potent lipopolysaccharide-binding antimicrobial and anti-inflammatory peptide

  • J Med Chem. 2013 May 9;56(9):3546-56. doi: 10.1021/jm4004158.
Lin Wei 1 Juanjuan Yang Xiaoqin He Guoxiang Mo Jing Hong Xiuwen Yan Donghai Lin Ren Lai
Affiliations

Affiliation

  • 1 Life Sciences College of Nanjing Agricultural University , Nanjing 210095, Jiangsu, China.
Abstract

Antimicrobial peptides (AMPs) play pivotal roles in the innate defense of vertebrates. A novel AMP (cathelicidin-PY) has been identified from the skin secretions of the frog Paa yunnanensis . Cathelicidin-PY has an amino acid sequence of RKCNFLCKLKEKLRTVITSHIDKVLRPQG. Nuclear magnetic resonance (NMR) spectroscopy analysis revealed that cathelicidin-PY adopts a tertiary structure with a mostly positively charged surface containing a helix (Thr15-Ser19). It possesses strong antimicrobial activity, low hemolytic activity, low cytotoxicity against RAW 264.7 cells, and strong anti-inflammatory activity. The action of antimicrobial activity of cathelicidin-PY is through the destruction of the cell membrane. Moreover, cathelicidin-PY exerts anti-inflammatory activity by inhibiting the production of nitric oxide (NO) and inflammatory cytokines such as tumor necrosis factor (TNF-α), interleukin-6 (IL-6), and monocyte chemoattractant protein-1 (MCP-1). Cathelicidin-PY inhibits the activation of Toll-like Receptor 4 (TLR4) inflammatory response pathways induced by lipopolysaccharide (LPS). The NMR titration experiments indicated that cathelicidin-PY can bind to LPS. In conclusion, we have identified a novel potent peptide Antibiotic with both antimicrobial and anti-inflammatory activities and laid the groundwork for future research and development.

Figures
Products