EGF 蛋白, Human

EGF Protein, Human is a potent epidermal growth factor, stimulates the proliferation of epidermal cells and is used in wound healing applications.

Recombinant Human Epidermal Growth Factor is chemically identical to the natural material, exhibits full biological activity and is ued in wound healing applications^[1]. Recombinant Human Epidermal Growth Factor (rhEGF) stimulates proliferation of the fibroblast BALB/c3T3 cell line. Recombinant Human Epidermal Growth Factor released from hydrogels keeps its bioactivity, induces EGF receptor expression, causes proliferating cell nuclear antigen and shows therapeutic potential in enhancing diabetic wound healing^[2].

Measured in a cell proliferation assay using BALB/c 3T3 cells. The ED50 for this effect is 60-450 pg/ml.

Human

E. coli

Tag Free

P01133 (N971-R1023)

1950  [NCBI]

MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Approximately 11 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized after extensive dialysis against 10mM Phosphate buffer, pH 7.0, 200 mM NaCl buffer.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Wong WR, et al. Applications, and efficient large-scale production, of recombinant human epidermal growth factor. Biotechnol Genet Eng Rev. 2001;18:51-71.  [Content Brief]

  [2]. Lao G, et al. Controlled release of epidermal growth factor from hydrogels accelerates wound healing in diabetic rats. J Am Podiatr Med Assoc. 2012 Mar-Apr;102(2):89-98.  [Content Brief]